The Law Office of Danielle J. Eliot Introduce
Navigating the complexities of personal and business finance can be one of life's most challenging experiences. For residents and families across Georgia, finding a trusted, local legal partner to help with significant financial decisions is crucial. The Law Office of Danielle J. Eliot, a reputable and compassionate law firm based in Woodstock, stands as a beacon for those seeking a fresh start through bankruptcy and debt relief. With a deep understanding of Georgia's legal landscape and a commitment to personalized client care, this firm offers a professional, supportive, and effective path forward. Whether you're dealing with overwhelming debt, facing garnishments, or struggling with the threat of repossession, having a knowledgeable attorney on your side can make all the difference. This overview will delve into the comprehensive services, notable features, and unwavering support provided by this women-owned law practice, helping you understand why they are a top choice for financial peace of mind in our community.
A significant portion of financial stress often stems from a lack of clear information and a feeling of being alone in the process. At The Law Office of Danielle J. Eliot, the focus is on demystifying the legal process and empowering clients with the knowledge they need to make the best decisions for their future. The team understands that every situation is unique and deserves a tailored approach. They are not just legal professionals; they are advocates who work tirelessly to ensure their clients feel heard, respected, and fully supported from the initial consultation to the final resolution. Their approach is built on a foundation of empathy and professionalism, recognizing the emotional toll that financial hardship can take on individuals and families. By providing clear, straightforward advice and a transparent process, they help to alleviate anxiety and restore a sense of control. Their deep expertise in various forms of bankruptcy, from Chapter 7 to Chapter 13, allows them to guide clients through the most suitable legal pathways to financial stability. This local expertise is invaluable for Georgia residents who need a firm that is well-versed in state-specific regulations and court procedures.
Located conveniently at 1001 Weatherstone Pkwy STE 420 in Woodstock, GA 30188, The Law Office of Danielle J. Eliot is easily accessible to clients throughout the North Georgia region, including those in Marietta, Canton, Roswell, and beyond. Its strategic location offers a comfortable and professional setting for in-person consultations. For those with mobility challenges, the firm is committed to providing a welcoming environment. The office features a wheelchair-accessible entrance, parking lot, restroom, and seating, ensuring that every client can access the legal support they need without barriers. This attention to detail reflects the firm's overall dedication to client comfort and inclusivity. The office is also equipped with modern amenities and a clean, accessible restroom for client convenience. For individuals who prefer or require remote services, the firm offers the flexibility of online appointments, making it easier than ever to get the legal advice you need from the comfort of your own home. This blend of on-site and virtual options caters to a wide range of client needs, demonstrating a commitment to accessibility that sets them apart.
The team at The Law Office of Danielle J. Eliot offers a comprehensive suite of legal services focused on helping Georgians overcome financial challenges. Their expertise covers various aspects of bankruptcy and debt relief, providing a holistic approach to financial recovery. The primary services include:
- Chapter 13 bankruptcy, a powerful tool for individuals with a regular income to reorganize their debts and pay them off over a set period. This can help save a home from foreclosure or a car from repossession.
- Chapter 7 bankruptcy, designed to provide a fresh start for individuals with overwhelming unsecured debt by liquidating certain assets to pay off creditors.
- Guidance on all aspects of Bankruptcy and Debt, from understanding the initial process to preparing all necessary documentation.
- Representation in Bankruptcy Cases, ensuring clients have expert legal counsel throughout court proceedings.
- Specialized services for Bankruptcy Law in Marietta, GA, and surrounding areas, including specific advice on local court requirements and procedures.
- Expert guidance through the entire Bankruptcy Process, making it as seamless and stress-free as possible.
- Debt Consolidation solutions that may provide an alternative to bankruptcy, helping to simplify payments and reduce interest.
- Effective Debt Relief Attorney services, providing tailored strategies to reduce or eliminate debt.
- Offering a Free Initial Consultation, which is a critical first step for anyone considering their financial options.
- Aggressive representation for Garnishment Attorney services, helping clients stop wage garnishments and protect their income.
- Skilled legal support for Repossession Attorney services, working to prevent the loss of a vehicle or other property.
The Law Office of Danielle J. Eliot prides itself on several key features that set it apart from other firms in the region. These highlights underscore their commitment to client-focused service and a compassionate approach to law:
- Identifies as a women-owned business, bringing a unique perspective and a focus on empathetic, client-centered service.
- Offers flexible service options, including convenient Online Appointments and Onsite Services, to accommodate diverse client needs and preferences.
- Commitment to accessibility with Wheelchair Accessible Entrance, Parking Lot, Restroom, and Seating, ensuring all clients can be served comfortably.
- A friendly and inclusive environment, identified as LGBTQ+ friendly, ensuring a welcoming space for all members of the community.
- Operational efficiency with an Appointment Required or Appointments Recommended policy, which ensures that every client receives focused, one-on-one attention without long wait times.
- Real-world results and praise from satisfied clients, such as a recent review that highlighted the team's professionalism and how they worked "overtime to ease my anxiety," leading to a successful bankruptcy discharge.
- A small, family-like firm atmosphere where clients are treated with respect and care, not just as another case number. One client's testimonial praises the firm for their communication, saying, "Thank you Kylie for answering all of my 'what if' calls."
For those ready to take the first step toward financial recovery, The Law Office of Danielle J. Eliot can be reached at the following contact points:
Address: 1001 Weatherstone Pkwy STE 420, Woodstock, GA 30188, USA
Phone: (770) 343-7570
What truly makes The Law Office of Danielle J. Eliot the right choice for Georgians facing financial distress is their unique blend of professional expertise and genuine compassion. This isn't just a law firm; it's a team of dedicated advocates who understand the profound impact that debt and financial uncertainty can have on a person's life. The reviews from real clients speak volumes, describing a firm that goes above and beyond to provide reassurance, clear communication, and a clear path forward. One client's powerful testimony perfectly captures the firm's ethos: "if you want to sleep at night, take care of your family, have a fresh start, and deal with a small firm that will treat you like family then Danielle Eliot is for you." This sentiment highlights a core belief of the practice—that a lawyer's role extends beyond legal documentation to providing emotional support and a sense of hope. The team, especially noted for the support from individuals like Kylie, is celebrated for its responsiveness and ability to ease client anxieties throughout the often-stressful bankruptcy process. The firm’s commitment to providing a free initial consultation also removes a significant barrier for many people who are unsure of their options or feel intimidated by the legal system. By offering this no-obligation meeting, they provide an opportunity for individuals to get truthful, expert advice and understand their potential for a fresh start. This proactive and compassionate approach is why so many in the community trust them to handle their most sensitive financial matters. They don't just process cases; they help people reclaim their lives.
The Law Office of Danielle J. Eliot Services
Bankruptcy Attorney
- Chapter 13 bankruptcy
Chapter 13 bankruptcy is a specific type of bankruptcy that applies to those earning a higher income. Chapter 13 can eliminate personal debts if the individual agrees to pay their discretionary income to creditors over time. Find out how our experienced bankruptcy lawyers can help.
- Chapter 7 bankruptcy
Both Chapter 7 & Chapter 13 personal bankruptcy can eliminate overwhelming debt, including credit card debt, bank loans, or medical bills. Learn more about how our firm can help in this post, where we explore the different aspects of bankruptcy law.
- Bankruptcy And Debt
- Bankruptcy Cases
- Bankruptcy Law Marietta GA
Law Office of Danielle J. Eliot, P.C. is located in Marietta and is dedicated to providing quality legal services in the following practice areas: Bankruptcy Law Firm Marietta, Chapter 7 Bankruptcy Law Marietta, Chapter 13 Bankruptcy Law Marietta, Garnishment Attorney Marietta, Repossession Attorney Marietta, Debt Relief Attorney Marietta. Call us today at (770) 672-6735. We can help! We look forward to hearing from you.
- Bankruptcy Process
- Chapter 13 Bankruptcy Law Marietta GA
Law Office of Danielle J. Eliot, P.C. is located in Marietta and is dedicated to providing quality legal services in the following practice areas: Bankruptcy Law Firm Marietta, Chapter 7 Bankruptcy Law Marietta, Chapter 13 Bankruptcy Law Marietta, Garnishment Attorney Marietta, Repossession Attorney Marietta, Debt Relief Attorney Marietta. Call us today at (770) 672-6735. We can help! We look forward to hearing from you.
- Chapter 7 Bankruptcy Law Marietta GA
Law Office of Danielle J. Eliot, P.C. is located in Marietta and is dedicated to providing quality legal services in the following practice areas: Bankruptcy Law Firm Marietta, Chapter 7 Bankruptcy Law Marietta, Chapter 13 Bankruptcy Law Marietta, Garnishment Attorney Marietta, Repossession Attorney Marietta, Debt Relief Attorney Marietta. Call us today at (770) 672-6735. We can help! We look forward to hearing from you.
- Debt Consolidation
- Debt Relief Attorney Marietta GA
Law Office of Danielle J. Eliot, P.C. is located in Marietta and is dedicated to providing quality legal services in the following practice areas: Bankruptcy Law Firm Marietta, Chapter 7 Bankruptcy Law Marietta, Chapter 13 Bankruptcy Law Marietta, Garnishment Attorney Marietta, Repossession Attorney Marietta, Debt Relief Attorney Marietta. Call us today at (770) 672-6735. We can help! We look forward to hearing from you.
- Free Initial Consultation
- Garnishment Attorney Marietta GA
Law Office of Danielle J. Eliot, P.C. is located in Marietta and is dedicated to providing quality legal services in the following practice areas: Bankruptcy Law Firm Marietta, Chapter 7 Bankruptcy Law Marietta, Chapter 13 Bankruptcy Law Marietta, Garnishment Attorney Marietta, Repossession Attorney Marietta, Debt Relief Attorney Marietta. Call us today at (770) 672-6735. We can help! We look forward to hearing from you.
- Repossession Attorney Marietta GA
Law Office of Danielle J. Eliot, P.C. is located in Marietta and is dedicated to providing quality legal services in the following practice areas: Bankruptcy Law Firm Marietta, Chapter 7 Bankruptcy Law Marietta, Chapter 13 Bankruptcy Law Marietta, Garnishment Attorney Marietta, Repossession Attorney Marietta, Debt Relief Attorney Marietta. Call us today at (770) 672-6735. We can help! We look forward to hearing from you.
The Law Office of Danielle J. Eliot Details
From the business
- Identifies as women-owned
Service options
- Online appointments
- Onsite services
Accessibility
- Wheelchair accessible entrance
- Wheelchair accessible parking lot
- Wheelchair accessible restroom
- Wheelchair accessible seating
Amenities
- Restroom
Crowd
- LGBTQ+ friendly
Planning
- Appointment required
- Appointments recommended
The Law Office of Danielle J. Eliot Photos
The Law Office of Danielle J. Eliot Location
The Law Office of Danielle J. Eliot
1001 Weatherstone Pkwy STE 420, Woodstock, GA 30188, USA
The Law Office of Danielle J. Eliot Reviews
questionsteamcallschoosinglaw firmemailsanswerhappycreditinformation
★ 5★ 4★ 3★ 2★ 1A Huge Thank You to Danielle and her team. They handled my case professional, so happy and grateful. I want to give a special shout out to Kylie! She was there for me answering all my questions.Highly recommend this law firm.
July 25 · Sharee WalkerAll I can say is Thank you Jesus. We had a very stressful 2023 and even more stressful 2024. With a family of 5 you start to wonder where you are going to live and how are we going to survive. A previous client told me about this law office. Needless to say this is the best decision we have ever made. I stressed throughout the entire process and these ladies worked overtime to ease my anxiety. They were right. I had our list of creditors ready and they took action. Went to court on May 15, received bankruptcy discharge on July 28th. Everyone's situation is different but I will tell you this....if you want to sleep at night, take care of your family, have a fresh start, and deal with a small firm that will treat you like family then Danielle Eliot is for you. Thank you Kylie for answering all of my "what if" calls. To anyone who reading this the answer is yes. Call them now. The process is not hard at all. Be truthful and everything will work out for you.
August 02 · MommyMJI was buried in 20 to 25k in credit card debt and personal loans, facing multiple judgements and a wage garnishment. I searched online and came across Attorney Eliott’s information and contacted her office. Jasime took the call and was very polite. She answered all my questions, sent me the intake packet and got my case started. The process was very simple. Attorney Eliot moved the case forward in a very seamless way. Not only is she an outstanding bankruptcy attorney. She is also a very wonderful person to work with. After speaking with her over the phone once or twice it became obvious to me that she genuinely cares about her clients. No one wants to file bankruptcy. But if you find yourself having to do so, Danielle Eliott is the attorney to call.
May 07 · AlexQuite seamless experience thus far. I probably wouldn’t have been able to file my bankruptcy without this Attorney because I was able to give a reasonable deposit to even start. I made the right choice. Emails and calls all answered and understood within reasonable time. TBH I called around , got consultations, and no offer was better than this office. Everything went in sequence and in good timing- overall a seamless experience.Thanks
January 03 · AI am so happy and grateful for choosing Danielle J Eliot's office. They are professional and handled my case with ease. I am sending a very special shout-out to Kylie! She was always there for me and answered all my questions. I 100% recommend this law office!
November 26 · Kathy Gattis
More law offices near me

120 E Main St #340, Murfreesboro, TN 37130, USA

201 E Main St Suite 250, Murfreesboro, TN 37130, USA

201 E Main St Suite 405, Murfreesboro, TN 37130, USA

120 E Main St Suite 210, Murfreesboro, TN 37130, USA

119 E Main St, Murfreesboro, TN 37130, USA

121 E Main St, Murfreesboro, TN 37130, USA

104 N Church St, Murfreesboro, TN 37130, USA

106a N Church St, Murfreesboro, TN 37130, USA

108 N Church St Suite 300, Murfreesboro, TN 37130, USA

108 N Church St, Murfreesboro, TN 37130, USA

108 N Church St, Murfreesboro, TN 37130, USA

106 E College St, Murfreesboro, TN 37130, USA
Categories
Top Visited Sites






Trending Law Made Simple Posts





